PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G26010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 838aa    MW: 91019.1 Da    PI: 6.1371
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G26010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-20133189157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  OGLUM04G26010.1 133 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 189
                      688999************************************************995 PP

2START204.15.6e-643235481206
                      HHHHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-S CS
            START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetla 77 
                      ela +a++elv++a+++ep+W+  +         e + ++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ + 
  OGLUM04G26010.1 323 ELAVAAMEELVRMAQLDEPLWSVAPpldaaaaamETLSEEEYARMFPRGLGpkqygLRSEASRDSAVVIMTHANLVEILMDANQyaaVFSNIVS 416
                      57899********************9*9999999999999999999887779*******************************66666666666 PP

                      EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
            START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                      +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skv
  OGLUM04G26010.1 417 RAVTLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYSKV 506
                      *****************************************************************98....7********************** PP

                      EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      twvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  OGLUM04G26010.1 507 TWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 548
                      ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-22113188IPR009057Homeodomain-like
SuperFamilySSF466897.1E-20120190IPR009057Homeodomain-like
PROSITE profilePS5007117.07130190IPR001356Homeobox domain
SMARTSM003892.3E-20131194IPR001356Homeobox domain
CDDcd000861.53E-19132191No hitNo description
PfamPF000464.6E-18133188IPR001356Homeobox domain
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PROSITE profilePS5084841.731314551IPR002913START domain
SuperFamilySSF559611.13E-34316550No hitNo description
CDDcd088754.75E-119318547No hitNo description
SMARTSM002349.5E-59323548IPR002913START domain
PfamPF018525.0E-54324548IPR002913START domain
Gene3DG3DSA:3.30.530.205.3E-6388544IPR023393START-like domain
SuperFamilySSF559614.39E-12569784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MIPARHMPSM IGRNGAAYGS SSALSLSQID RTMERREIFQ VADLAHILRG KPVDHLQQPN  60
LLDNHQFQQA FQHQQQQHHL LDQIPATTAE SGDNMIRSRA SDPLGDEFES KSGSENVDGV  120
SVDDQDPNQR PRKKRYHRHT QHQIQEMEAF FKECPHPDDK QRKELSRELG LEPLQVKFWF  180
QNKRTQMKNQ HERHENSQLR SDNEKLRAEN MRYKEALSSA SCPNCGGPAA LGEMSFDEHH  240
LRIENARLRE EIDRISAIAA KYVGKPMVPF PVLSNPMAAA ASRAPLDLPV APYGVPGDMF  300
GGGGAGELLR GVQSEVDKPM IVELAVAAME ELVRMAQLDE PLWSVAPPLD AAAAAMETLS  360
EEEYARMFPR GLGPKQYGLR SEASRDSAVV IMTHANLVEI LMDANQYAAV FSNIVSRAVT  420
LEVLSTGVAG NYNGALQVMS VEFQVPSPLV PTRESYFVRY CKQNADGTWA VVDVSLDSLR  480
PSPVLKCRRR PSGCLIQEMP NGYSKVTWVE HVEVDDRSVH NIYKLLVNSG LAFGARRWVG  540
TLDRQCERLA SVMASNIPTS DIGVITSSEG RKSMLKLAER MVVSFCGGVT ASVAHQWTTL  600
SGSGAEDVRV MTRKSVDDPG RPPGIVLNAA TSFWLPWDIL SNGGIVQEMA HIANGRDQGN  660
CVSLLRVNSS NSNQSNMLIL QESCTDASGS YVIYAPVDVV AMNVVLNGGD PDYVALLPSG  720
FAILPDGPAH DGGGGDGGVG VGSGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIACTV  780
ERIKAAVSGE SNPQSSKILE LSSVGSQERT SDCPCHVFFL AASMKAMLIS VSSSGRVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636340.10.0PREDICTED: homeobox-leucine zipper protein ROC2 isoform X2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLA0A0D9ZR240.0A0A0D9ZR24_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g53540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2